PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn050491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 674aa    MW: 76585.4 Da    PI: 4.4191
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn050491genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.76.5e-091443130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     rg W++eEde+l++++  +G g+W+t++  
       Achn050491 14 RGLWSPEEDEKLINYISTYGHGCWSTVPTL 43
                     788***********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-13543IPR009057Homeodomain-like
SuperFamilySSF466891.05E-7945IPR009057Homeodomain-like
PROSITE profilePS512949.024959IPR017930Myb domain
PfamPF002491.2E-61442IPR001005SANT/Myb domain
CDDcd001676.06E-51747No hitNo description
SuperFamilySSF1431131.23E-78127393No hitNo description
PfamPF009564.3E-81151394IPR002164Nucleosome assembly protein (NAP)
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006334Biological Processnucleosome assembly
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MGHHTCCNKQ KVKRGLWSPE EDEKLINYIS TYGHGCWSTV PTLADHMQCM TETAIDDNRG  60
YSVARNFKSK QNRNDLSSTL GCFADHNSPS MSNTNKDQFD MSDLGADLPA AAAALSAEDR  120
AGLVNALKNK LQNLAGEHSE VLENLSPNVR RRVEVLREMQ SQHDELEAKF FEERAALEAK  180
YQKLYEPLYT KRFEIVNGVV EVGGVTSEAT MDNEDKETEE KGVPNFWVTA MKTNEVLAEE  240
VSERDEAALK YLKDIKWCRI DNPKGFKLEF FFDTNPFFKN TVLTKTYHMI DDDEPILEKA  300
IGMEIEWYPG RCLTQKILKK KPKKGSKNSK PITKTENCES FFKFFNPPQV PEDEDDIDED  360
TAEELQNQME QDYDIGSTIR DKIIPHAVSW FTGEAVQGDD FEDLDDEDED EDEEEDGDED  420
EEDEDEDDED EDEDEEEGKS RKKDYDTEHD TGKNDGADPV EDSDLLREFH LVNEKKSLLI  480
QELRSQNSTM NANMLMLQKQ LSEMEEAAEN AKHAYQQELQ MENVKRSWRS RMLNANPVSG  540
FAATQVKYLK KLILKDTEIL ILPLNVFVVI PKNSSISPHM HTQAAKAVVP KTLGNVSPFE  600
LSTAHVIRHG QDLQCHLTPI SDEMASQVRL LGLKLWGILD LSPTRLIELA VNHFDSSPLI  660
LLATKAFLPK PQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3gyw_A2e-3815639314247Nucleosome assembly protein 1, putative
3gyv_A2e-3815639314247Nucleosome assembly protein 1, putative
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.29e-23myb domain protein 26